Vender en Zazzle
Pulsa / haz clic en la imagen para ver más RealViewsMarca registrada
16,20 €
Por Globo de nieve
 

happy new year 2026 rustic snow globe

de
Cant:

Sobre Snow Globes

Vendido por
Snow Globe
Crear desde cero

Estilo: Globo de nieve con cúpula

Las bolas de nieve con fotos son una manera divertida y única de mostrar tus recuerdos favoritos, lo que las convierte en el regalo perfecto para amigos y familiares. Hay algo realmente especial en un regalo personalizado hecho con amor.

  • Dimensiones de la bola: aprox. 8,4 cm (L) × 8,4 cm (H)
  • Tamaño de la imagen interna: aprox. 6 cm (L) × 7 cm (H)
  • Bola y base de acrílico
  • Impresión personalizable a doble cara
  • No es un juguete. Recomendado para mayores de 14 años
  • Cada bola contiene un total de aprox. 180 ml de agua, por lo que NO cumple con las normas de la TSA para equipaje de mano.

Sobre este diseño

happy new year 2026 rustic snow globe

happy new year 2026 rustic snow globe

This wreath motif would look charming inside a new year snow globe 2025. The glitter crystal new year globe feeling appears when you imagine it with snow. It can become a happy new year keepsake gift for nature lovers. The elegant new year snow ball mood matches the pinecones and stars. People enjoy a winter holiday collectible globe that feels peaceful. Overall it turns into a luxury new year gift globe with rustic style.
ZbDigitalMart
Diseñado por
Katwa, West Bengal, India
Ver su tienda

Reseñas de clientes

No hay comentarios sobre este producto todavía.¿Has comprado este producto?

Etiquetas

Snow Globes
newyearsnowglobe2025glittercrystalnewyearglobehappynewyearkeepsakegiftelegantnewyearsnowballwinterholidaycollectibleglobeluxurynewyeargiftglobestylishholidaydeskdecorblackgoldsnowglobedecorpremiumsnowglobesouvenirglowingnewyearsnowglobe
Todos los productos
newyearsnowglobe2025glittercrystalnewyearglobehappynewyearkeepsakegiftelegantnewyearsnowballwinterholidaycollectibleglobeluxurynewyeargiftglobestylishholidaydeskdecorblackgoldsnowglobedecorpremiumsnowglobesouvenirglowingnewyearsnowglobe

Información adicional

Número del producto: 256442318044430840
Creado el: 21/11/2025 23:57
Clasificación: G